| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331301.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| LFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQG HMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQPDENVTNDQI | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,081.705 | ||
| Theoretical pI: | 4.857 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.505 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.208 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331301.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| LFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQG HMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQPDENVTNDQI | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,081.705 | ||
| Theoretical pI: | 4.857 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.505 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.208 | ||
| sheet | 0.223 | ||