| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331309.1 | complete | 154 | 2-466(+) |
Amino Acid sequence : | |||
| MFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLG HELFSRLLSQAVDQAKELMDQFQLVHIVASLTLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,151.259 | ||
| Theoretical pI: | 4.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 39.210 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.201 | ||
| sheet | 0.292 | ||