Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331309.1	complete	154	2-466(+)
Amino Acid sequence :
MFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLG HELFSRLLSQAVDQAKELMDQFQLVHIVASLTLA*
Physicochemical properties
Number of amino acids:		154
Molecular weight:		17,151.259
Theoretical pI:		4.555
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15470
Instability index:		39.210
aromaticity		0.084
GRAVY		0.031
Secondary Structure Fraction
Helix		0.351
turn		0.201
sheet		0.292