| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331312.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| YFLIMEFKNLSILAFLSVAIVVSHAALPSEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLE KDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFAT | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,242.766 | ||
| Theoretical pI: | 5.213 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 43.156 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.495 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.226 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331312.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| YFLIMEFKNLSILAFLSVAIVVSHAALPSEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLE KDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFAT | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,242.766 | ||
| Theoretical pI: | 5.213 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 43.156 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.495 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.226 | ||
| sheet | 0.255 | ||