| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331317.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| QNSSFNANAYGRGGLPGGIPSSGYQDPRFAFDGLHSPIPWIETPYFPDAQPRPVTSSSTTSAVGNGNSVPSSRNQNYRPHAMGLNHPRPIPTMNTANGYMNRMYPNKLYGQYGNTYRSGV YGSNGYDTRAGGRAWMAVDSKYKPRGRGNGFYGYGNESMDGLNELNRGPRTKSTKNLKGFTPVTLAVKGQNIPLAETADNEKLSVIPDREQYNRPDFPETYSDVKFFIIKSYSEDECHKS IKYNI | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,164.702 | ||
| Theoretical pI: | 9.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37820 37820 | ||
| Instability index: | 31.725 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.906 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.384 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331317.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| QNSSFNANAYGRGGLPGGIPSSGYQDPRFAFDGLHSPIPWIETPYFPDAQPRPVTSSSTTSAVGNGNSVPSSRNQNYRPHAMGLNHPRPIPTMNTANGYMNRMYPNKLYGQYGNTYRSGV YGSNGYDTRAGGRAWMAVDSKYKPRGRGNGFYGYGNESMDGLNELNRGPRTKSTKNLKGFTPVTLAVKGQNIPLAETADNEKLSVIPDREQYNRPDFPETYSDVKFFIIKSYSEDECHKS IKYNI | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,164.702 | ||
| Theoretical pI: | 9.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37820 37820 | ||
| Instability index: | 31.725 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.906 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.384 | ||
| sheet | 0.155 | ||