| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331318.1 | internal | 218 | 2-655(+) |
Amino Acid sequence : | |||
| FCMGISTNHALFDGKSFKHFLENLASQAFDDKPIHVIPCNDRRLLAARSPPQVTFPHPELLKLKIPIGQEETPPIFDCKQEDLDFKIFTLTPQHINSLKDKARTGATAKITGFNAVSAHI WRCKALSCAKDNNRDRESTVLYAVDIRSRLNPPLPDAYCGNAVLTAYATAKCSVLEDEPLSRAVEMVAEASARMTDEYARSVINWGELYKGFPNGEFL | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 15,200.744 | ||
| Theoretical pI: | 11.180 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
| Instability index: | 74.430 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.263 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331318.1 | complete | 137 | 438-25(-) |
Amino Acid sequence : | |||
| MSTAYKTVDSRSRLLSLAQDSALHRQMWAETALKPVIFAVAPVLALSFRELMCWGVRVKILKSRSSCLQSNIGGVSSWPIGILSLRSSGWGKVTCGGERAARRRRSLHGMTWMGLSSKAW EARFSKKCLKLFPSNKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,200.744 | ||
| Theoretical pI: | 11.180 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
| Instability index: | 74.430 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.263 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331318.1 | internal | 218 | 2-655(+) |
Amino Acid sequence : | |||
| FCMGISTNHALFDGKSFKHFLENLASQAFDDKPIHVIPCNDRRLLAARSPPQVTFPHPELLKLKIPIGQEETPPIFDCKQEDLDFKIFTLTPQHINSLKDKARTGATAKITGFNAVSAHI WRCKALSCAKDNNRDRESTVLYAVDIRSRLNPPLPDAYCGNAVLTAYATAKCSVLEDEPLSRAVEMVAEASARMTDEYARSVINWGELYKGFPNGEFL | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 15,200.744 | ||
| Theoretical pI: | 11.180 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
| Instability index: | 74.430 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.263 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331318.1 | complete | 137 | 438-25(-) |
Amino Acid sequence : | |||
| MSTAYKTVDSRSRLLSLAQDSALHRQMWAETALKPVIFAVAPVLALSFRELMCWGVRVKILKSRSSCLQSNIGGVSSWPIGILSLRSSGWGKVTCGGERAARRRRSLHGMTWMGLSSKAW EARFSKKCLKLFPSNKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,200.744 | ||
| Theoretical pI: | 11.180 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
| Instability index: | 74.430 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.263 | ||
| sheet | 0.277 | ||