| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331326.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
| IEVSGMQFSYDATSPLFFDFNLKISPGSRSLLVGANGSGKTTLLRILAGKHMVGGRDAVRVLNCSAFHDTNLVCSGDLAYLGESWSKTVGSAGELPLQGDFSAEHMIYGVEGVDPVRRDK LIELLDINLQWRMHKVSDGQRRRVQICMGLLHPYKVLLLDEVTVDLDVVARMDLLEFFREECEQRGATIVYATHIFDGLETWA | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,578.623 | ||
| Theoretical pI: | 5.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 39.230 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.212 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331326.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
| IEVSGMQFSYDATSPLFFDFNLKISPGSRSLLVGANGSGKTTLLRILAGKHMVGGRDAVRVLNCSAFHDTNLVCSGDLAYLGESWSKTVGSAGELPLQGDFSAEHMIYGVEGVDPVRRDK LIELLDINLQWRMHKVSDGQRRRVQICMGLLHPYKVLLLDEVTVDLDVVARMDLLEFFREECEQRGATIVYATHIFDGLETWA | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,578.623 | ||
| Theoretical pI: | 5.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 39.230 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.212 | ||
| sheet | 0.276 | ||