| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331345.1 | 3prime_partial | 206 | 57-674(+) |
Amino Acid sequence : | |||
| MLRVAGRRLSSLSWRPSQSLPASFVSRNPFVGGDSSLDGHAGSISSSVQSISLFDPIRGFSSGSLAPGKDTSLIPDIPATVAAIKNPSPKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLARLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDIKLANSVDIASLRDPQEDAVRVKNP | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,372.825 | ||
| Theoretical pI: | 11.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 60.276 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.314 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331345.1 | 5prime_partial | 154 | 674-210(-) |
Amino Acid sequence : | |||
| WILNPHSILLWITKRGNVNTVCQLDVFFSSAPDEHWLSTPLHSNGCPWFNTRQIHFERSKSKDIFTSRHAQHKFQHKESGQRRIHKPASSQNKVCKCTFAGITRGITLVVVLIINNLWTG ILDCCHCSRNVWNQACILPWCKATRREPSNRIKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 11,372.825 | ||
| Theoretical pI: | 11.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 60.276 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.314 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331345.1 | 5prime_partial | 105 | 673-356(-) |
Amino Acid sequence : | |||
| GFLTLTASSCGSRREAMSTLFANLMSSSVRRLMNTGFPRHFTVTVVPGSILDRSTSREARARTSLLADMLNTNFSTRSRANDAYTNLPPVKTKYANARLLGSPGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,372.825 | ||
| Theoretical pI: | 11.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 60.276 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.314 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331345.1 | 3prime_partial | 206 | 57-674(+) |
Amino Acid sequence : | |||
| MLRVAGRRLSSLSWRPSQSLPASFVSRNPFVGGDSSLDGHAGSISSSVQSISLFDPIRGFSSGSLAPGKDTSLIPDIPATVAAIKNPSPKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLARLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDIKLANSVDIASLRDPQEDAVRVKNP | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,372.825 | ||
| Theoretical pI: | 11.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 60.276 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.314 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331345.1 | 5prime_partial | 154 | 674-210(-) |
Amino Acid sequence : | |||
| WILNPHSILLWITKRGNVNTVCQLDVFFSSAPDEHWLSTPLHSNGCPWFNTRQIHFERSKSKDIFTSRHAQHKFQHKESGQRRIHKPASSQNKVCKCTFAGITRGITLVVVLIINNLWTG ILDCCHCSRNVWNQACILPWCKATRREPSNRIKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 11,372.825 | ||
| Theoretical pI: | 11.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 60.276 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.314 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331345.1 | 5prime_partial | 105 | 673-356(-) |
Amino Acid sequence : | |||
| GFLTLTASSCGSRREAMSTLFANLMSSSVRRLMNTGFPRHFTVTVVPGSILDRSTSREARARTSLLADMLNTNFSTRSRANDAYTNLPPVKTKYANARLLGSPGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,372.825 | ||
| Theoretical pI: | 11.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 60.276 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.314 | ||
| sheet | 0.267 | ||