| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331347.1 | 5prime_partial | 163 | 2-493(+) |
Amino Acid sequence : | |||
| PLQYPQVLHPAADSININAQIWDMYFKNLLPRLVKEGDDGNYGSAASCDTICLQALSKRIHYGKFVAEAKFRKSPDEYTPAIKAQDKDELMRLLTYVDVEEVVRRRVEMKTRKYGQEVTL TEDAENTEPVYKINPSIVADLYWDWIMPLTKQVQVEYLLRRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 18,971.491 | ||
| Theoretical pI: | 5.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 49.661 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.160 | ||
| sheet | 0.270 | ||