| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331352.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| LSRNSLGRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVW PYMETFTEDVAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALEKTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPG | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,087.840 | ||
| Theoretical pI: | 6.080 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 30.724 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.192 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331352.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| LSRNSLGRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVW PYMETFTEDVAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALEKTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPG | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,087.840 | ||
| Theoretical pI: | 6.080 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 30.724 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.192 | ||
| sheet | 0.246 | ||