Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331362.1 | 5prime_partial | 157 | 2-475(+) |
Amino Acid sequence : | |||
EALNAEEAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFEANILAVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSGYVKAAQKLHEMDPLHKPKQD RYALRTSPQWLGPQIEVLRTAHQDDREGESTLSTTTL* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,022.111 | ||
Theoretical pI: | 5.417 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 40.661 | ||
aromaticity | 0.057 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.210 | ||
sheet | 0.363 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331362.1 | 5prime_partial | 157 | 2-475(+) |
Amino Acid sequence : | |||
EALNAEEAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFEANILAVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSGYVKAAQKLHEMDPLHKPKQD RYALRTSPQWLGPQIEVLRTAHQDDREGESTLSTTTL* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,022.111 | ||
Theoretical pI: | 5.417 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 40.661 | ||
aromaticity | 0.057 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.210 | ||
sheet | 0.363 |