| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331367.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| VKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS ITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEESEGKLKGILGYTEDDVVSTDFGGDNRSSIFDAKAG I | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 25,510.729 | ||
| Theoretical pI: | 5.586 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 21.694 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.241 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331367.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| VKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS ITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEESEGKLKGILGYTEDDVVSTDFGGDNRSSIFDAKAG I | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 25,510.729 | ||
| Theoretical pI: | 5.586 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 21.694 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.241 | ||
| sheet | 0.241 | ||