| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331369.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| EAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWV QSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITN GG | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 27,365.955 | ||
| Theoretical pI: | 7.985 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 42.402 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.198 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331369.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| EAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWV QSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITN GG | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 27,365.955 | ||
| Theoretical pI: | 7.985 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 42.402 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.198 | ||
| sheet | 0.269 | ||