| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331375.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
| SSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKK PEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNP SGRVVIGGPHGNAGLTGRKNFIDTYGGW | |||
Physicochemical properties | |||
| Number of amino acids: | 268 | ||
| Molecular weight: | 29,328.788 | ||
| Theoretical pI: | 5.243 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
| Instability index: | 29.858 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.409 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.220 | ||
| sheet | 0.201 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331375.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
| SSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKK PEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNP SGRVVIGGPHGNAGLTGRKNFIDTYGGW | |||
Physicochemical properties | |||
| Number of amino acids: | 268 | ||
| Molecular weight: | 29,328.788 | ||
| Theoretical pI: | 5.243 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
| Instability index: | 29.858 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.409 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.220 | ||
| sheet | 0.201 | ||