| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331377.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| LRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHG HLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKP | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,050.005 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 36.316 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.202 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331377.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| LRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHG HLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKP | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,050.005 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 36.316 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.202 | ||
| sheet | 0.224 | ||