| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331383.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| RLQTSPIDGQKPGTSGLRKKVKVFLQPNYLQNFVQSTFNALGADKVKGVTLVVSGDGRYYSKDAIQIIIKMAAANGVRRIWVGQNGLLSTPAVSAVIRERVGPDGSKANGAFILTASHNP GGPNEDFGIKYNMENGGPAPEAITDKIYSNTTTIKEYLIAEDLPDVDISKTGVNAFSGSEGPFDVEVFDAAIDYVKLMKTIFDFQSIKKLLSSPKFTFCYDALHGVGGAYAK | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 24,961.101 | ||
| Theoretical pI: | 8.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 28.419 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.276 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331383.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| RLQTSPIDGQKPGTSGLRKKVKVFLQPNYLQNFVQSTFNALGADKVKGVTLVVSGDGRYYSKDAIQIIIKMAAANGVRRIWVGQNGLLSTPAVSAVIRERVGPDGSKANGAFILTASHNP GGPNEDFGIKYNMENGGPAPEAITDKIYSNTTTIKEYLIAEDLPDVDISKTGVNAFSGSEGPFDVEVFDAAIDYVKLMKTIFDFQSIKKLLSSPKFTFCYDALHGVGGAYAK | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 24,961.101 | ||
| Theoretical pI: | 8.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 28.419 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.276 | ||
| sheet | 0.198 | ||