| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331389.1 | 5prime_partial | 244 | 3-737(+) |
Amino Acid sequence : | |||
| KMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSF FRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQ TDYV* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,386.268 | ||
| Theoretical pI: | 6.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
| Instability index: | 38.393 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.270 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331389.1 | 5prime_partial | 244 | 3-737(+) |
Amino Acid sequence : | |||
| KMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSF FRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQ TDYV* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,386.268 | ||
| Theoretical pI: | 6.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
| Instability index: | 38.393 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.270 | ||
| sheet | 0.258 | ||