| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331396.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
| ELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTK KEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMGQEAEKYKS | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 24,554.774 | ||
| Theoretical pI: | 5.261 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 24.507 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.379 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.237 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331396.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
| ELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTK KEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMGQEAEKYKS | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 24,554.774 | ||
| Theoretical pI: | 5.261 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 24.507 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.379 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.237 | ||
| sheet | 0.250 | ||