| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331409.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
| IPHPIFHLKPQKHTISFTGAKMVTVEEIRRAQRAEGPATLLAIGTATPSHCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVV VEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVT | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,055.986 | ||
| Theoretical pI: | 6.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.646 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.211 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331409.1 | internal | 218 | 656-3(-) |
Amino Acid sequence : | |||
| GDGGDLRADNQNPSAGVVLGEVLGHAEDGAAGEAALLVHHEALDGGAEAEEFGELVVGAGHVDAAGGAENEVGDFGFGLPPFLDGLLRRLFPQLRHLHHHDVLPRVQRRRHVRRHVRILL QKLFRQVHVPFPYHRFLAHALEFFFEISFVLAVCNTEVVIRIGALVNAMRGRGGADRQQGGRTLGALSPADLFHRHHFCAGKRNGVFLWFEVENRVRY | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,055.986 | ||
| Theoretical pI: | 6.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.646 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.211 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331409.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
| IPHPIFHLKPQKHTISFTGAKMVTVEEIRRAQRAEGPATLLAIGTATPSHCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVV VEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVT | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,055.986 | ||
| Theoretical pI: | 6.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.646 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.211 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331409.1 | internal | 218 | 656-3(-) |
Amino Acid sequence : | |||
| GDGGDLRADNQNPSAGVVLGEVLGHAEDGAAGEAALLVHHEALDGGAEAEEFGELVVGAGHVDAAGGAENEVGDFGFGLPPFLDGLLRRLFPQLRHLHHHDVLPRVQRRRHVRRHVRILL QKLFRQVHVPFPYHRFLAHALEFFFEISFVLAVCNTEVVIRIGALVNAMRGRGGADRQQGGRTLGALSPADLFHRHHFCAGKRNGVFLWFEVENRVRY | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,055.986 | ||
| Theoretical pI: | 6.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.646 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.211 | ||
| sheet | 0.298 | ||