| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331414.1 | internal | 186 | 560-3(-) |
Amino Acid sequence : | |||
| TGLRQAPRESISQLIDHANSHPAPIVAVDIPSGLLAETGATPGAVINADHTITFIALKPGLLTGKARDVTGQLHFDSLGLDSWLAGQETKIQRFSAEQLSHWLKPRRPTSHKGDHGRLVI IGGDHGTAGAIRMTGEAALRAGAGLVRVLTRSENIAPLLTARPELMVHELTMDSLTESLEWADVVV | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 19,817.349 | ||
| Theoretical pI: | 6.277 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 28.164 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.231 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331414.1 | internal | 186 | 560-3(-) |
Amino Acid sequence : | |||
| TGLRQAPRESISQLIDHANSHPAPIVAVDIPSGLLAETGATPGAVINADHTITFIALKPGLLTGKARDVTGQLHFDSLGLDSWLAGQETKIQRFSAEQLSHWLKPRRPTSHKGDHGRLVI IGGDHGTAGAIRMTGEAALRAGAGLVRVLTRSENIAPLLTARPELMVHELTMDSLTESLEWADVVV | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 19,817.349 | ||
| Theoretical pI: | 6.277 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 28.164 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.231 | ||
| sheet | 0.306 | ||