| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331415.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
| GTGLRQAPRESISQLIDHANSHPAPIVAVDIPSGLLAETGATPGAVINADHTITFIALKPGLLTGKARDVTGQLHFDSLGLDSWLAGQETKIQRFSAEQLSHWLKPRRPTSHKGDHGRLV IIGGDHGTAGAIRMTGEAALRAGAGLVRVLTRSENIAPLLTARPELMVHELTMDSLTESLEWADVVVIGPGLGQQE | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 20,754.357 | ||
| Theoretical pI: | 6.136 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 28.769 | ||
| aromaticity | 0.031 | ||
| GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.245 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331415.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
| GTGLRQAPRESISQLIDHANSHPAPIVAVDIPSGLLAETGATPGAVINADHTITFIALKPGLLTGKARDVTGQLHFDSLGLDSWLAGQETKIQRFSAEQLSHWLKPRRPTSHKGDHGRLV IIGGDHGTAGAIRMTGEAALRAGAGLVRVLTRSENIAPLLTARPELMVHELTMDSLTESLEWADVVVIGPGLGQQE | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 20,754.357 | ||
| Theoretical pI: | 6.136 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 28.769 | ||
| aromaticity | 0.031 | ||
| GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.245 | ||
| sheet | 0.301 | ||