Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331417.1 | internal | 199 | 599-3(-) |
Amino Acid sequence : | |||
SLSALVKAGVSGEAQIASISQSVARFSSASGVEVDKVAEAFGKLTTDPTSGLTAMARQFHNVSAEQIAYVAQLQRSGDEAGALQAANEAATKGFDDQTRRLKENMGTLETWADRTARAFK SMWDAVLDIGRPDTAQEMLIKAEAAYKKADDIWNLRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQ | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 10,625.917 | ||
Theoretical pI: | 11.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 125.185 | ||
aromaticity | 0.020 | ||
GRAVY | -1.029 | ||
Secondary Structure Fraction | |||
Helix | 0.091 | ||
turn | 0.424 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331417.1 | 5prime_partial | 198 | 3-599(+) |
Amino Acid sequence : | |||
LRIFVLLSLLLSLLSGGFKRKTGLFTIIPVTRPRFIVNKIIILAQIPDVVCFLIRSLCLNQHLLRGIRTTNIQHRIPHGFECPRSPVCPGLQRAHVLFQAAGLVIKPFRCGLVRRLQCPG FIAGTLQLSNIRNLLRRHVMELASHRRQPRRRVCGQLPEGFSDLVHLHAGCRGETRHTLADGRNLSLTAYPRLNQCAE* | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 10,625.917 | ||
Theoretical pI: | 11.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 125.185 | ||
aromaticity | 0.020 | ||
GRAVY | -1.029 | ||
Secondary Structure Fraction | |||
Helix | 0.091 | ||
turn | 0.424 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331417.1 | complete | 99 | 245-544(+) |
Amino Acid sequence : | |||
MPAQSCLPRSPACPCSLSGGGSGHQTLSLRPRSPPAMPRLHRRNAATEQHTQSAPPTRYGTGEPSPSAPTSGLWSASRRLQRPCPPPRRMQRRNAPHSG* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,625.917 | ||
Theoretical pI: | 11.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 125.185 | ||
aromaticity | 0.020 | ||
GRAVY | -1.029 | ||
Secondary Structure Fraction | |||
Helix | 0.091 | ||
turn | 0.424 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331417.1 | internal | 199 | 599-3(-) |
Amino Acid sequence : | |||
SLSALVKAGVSGEAQIASISQSVARFSSASGVEVDKVAEAFGKLTTDPTSGLTAMARQFHNVSAEQIAYVAQLQRSGDEAGALQAANEAATKGFDDQTRRLKENMGTLETWADRTARAFK SMWDAVLDIGRPDTAQEMLIKAEAAYKKADDIWNLRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQ | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 10,625.917 | ||
Theoretical pI: | 11.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 125.185 | ||
aromaticity | 0.020 | ||
GRAVY | -1.029 | ||
Secondary Structure Fraction | |||
Helix | 0.091 | ||
turn | 0.424 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331417.1 | 5prime_partial | 198 | 3-599(+) |
Amino Acid sequence : | |||
LRIFVLLSLLLSLLSGGFKRKTGLFTIIPVTRPRFIVNKIIILAQIPDVVCFLIRSLCLNQHLLRGIRTTNIQHRIPHGFECPRSPVCPGLQRAHVLFQAAGLVIKPFRCGLVRRLQCPG FIAGTLQLSNIRNLLRRHVMELASHRRQPRRRVCGQLPEGFSDLVHLHAGCRGETRHTLADGRNLSLTAYPRLNQCAE* | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 10,625.917 | ||
Theoretical pI: | 11.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 125.185 | ||
aromaticity | 0.020 | ||
GRAVY | -1.029 | ||
Secondary Structure Fraction | |||
Helix | 0.091 | ||
turn | 0.424 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331417.1 | complete | 99 | 245-544(+) |
Amino Acid sequence : | |||
MPAQSCLPRSPACPCSLSGGGSGHQTLSLRPRSPPAMPRLHRRNAATEQHTQSAPPTRYGTGEPSPSAPTSGLWSASRRLQRPCPPPRRMQRRNAPHSG* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,625.917 | ||
Theoretical pI: | 11.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 125.185 | ||
aromaticity | 0.020 | ||
GRAVY | -1.029 | ||
Secondary Structure Fraction | |||
Helix | 0.091 | ||
turn | 0.424 | ||
sheet | 0.212 |