Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331418.1 | complete | 181 | 117-662(+) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 15,995.948 | ||
Theoretical pI: | 6.327 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 41.923 | ||
aromaticity | 0.076 | ||
GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.201 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331418.1 | 5prime_partial | 144 | 702-268(-) |
Amino Acid sequence : | |||
CEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVL KVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,995.948 | ||
Theoretical pI: | 6.327 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 41.923 | ||
aromaticity | 0.076 | ||
GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.201 | ||
sheet | 0.222 |