| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331420.1 | 5prime_partial | 212 | 678-40(-) |
Amino Acid sequence : | |||
| DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKP EEFRPERFLEEEAKVEASGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 13,492.362 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 39.982 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.213 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331420.1 | complete | 122 | 73-441(+) |
Amino Acid sequence : | |||
| MLQNVKTELPTFLRGIDLRLPWRRQQLEVLYESAQCNTQNRQCKDNTRAAPSADAKGEVPKVIATGLDFSLLFQESLGPELLGLFPLGRVVGQPPRIHQDLALGGDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,492.362 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 39.982 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.213 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331420.1 | 5prime_partial | 212 | 678-40(-) |
Amino Acid sequence : | |||
| DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKP EEFRPERFLEEEAKVEASGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 13,492.362 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 39.982 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.213 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331420.1 | complete | 122 | 73-441(+) |
Amino Acid sequence : | |||
| MLQNVKTELPTFLRGIDLRLPWRRQQLEVLYESAQCNTQNRQCKDNTRAAPSADAKGEVPKVIATGLDFSLLFQESLGPELLGLFPLGRVVGQPPRIHQDLALGGDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,492.362 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 39.982 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.213 | ||
| sheet | 0.295 | ||