| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
| TTSTAAKSPPPPPPEMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNV VFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRTGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFE | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | internal | 236 | 708-1(-) |
Amino Acid sequence : | |||
| LEALRQSTPLPIQRLQFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGGLRLPPGAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIEHNIAS SRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEEKIHFRWWWWWRFRGGGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
| PPPPPRNLHHHHHRKWIFSSSRRRFSASSSPSSSPPWSRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAML CSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
| HLHRREISTTTTTGNGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | 5prime_partial | 99 | 707-408(-) |
Amino Acid sequence : | |||
| SKLCANRLLSPFNAFNFTNNGSSSLSNLLSNIIRYMLLYIISCRRRLNTIPFVADSGFFFTSSTTAAASASHPVRYCCTTLLVKNGTVMIRRIFRQCSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
| TTSTAAKSPPPPPPEMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNV VFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRTGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFE | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | internal | 236 | 708-1(-) |
Amino Acid sequence : | |||
| LEALRQSTPLPIQRLQFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGGLRLPPGAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIEHNIAS SRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEEKIHFRWWWWWRFRGGGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
| PPPPPRNLHHHHHRKWIFSSSRRRFSASSSPSSSPPWSRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAML CSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
| HLHRREISTTTTTGNGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331421.1 | 5prime_partial | 99 | 707-408(-) |
Amino Acid sequence : | |||
| SKLCANRLLSPFNAFNFTNNGSSSLSNLLSNIIRYMLLYIISCRRRLNTIPFVADSGFFFTSSTTAAASASHPVRYCCTTLLVKNGTVMIRRIFRQCSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,050.761 | ||
| Theoretical pI: | 10.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 54.499 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||