Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331443.1 | 5prime_partial | 186 | 755-195(-) |
Amino Acid sequence : | |||
PAPGSPELADRVKPLLNKSGFETVHVDDTRGLDHGAWVPLMLMYPEADIPVVQLSVQTDKDASHHYRLGEALRPLKEDGVLIFGSGAATHNLRKISRDGSNEVAEWAEEFDRWIGKALEE GRYEDVNRYEEKAPHAKMAHPWPDHFYPLHVAMGAAGENTRGELIHHSWTHGTLSYASYRFAEKAK* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,348.884 | ||
Theoretical pI: | 11.830 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 51.385 | ||
aromaticity | 0.028 | ||
GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.188 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331443.1 | complete | 181 | 165-710(+) |
Amino Acid sequence : | |||
MHKQVKTKLSLFSFLGESVRRIGQGPVRPAMVDELAPRVLAGGAHRHVQRVEMVRPGVRHLRVRRLLLIPIHILIPPLLQRLPDPPVKLLRPLRHLVAAVAADLPQIVRGGAGSEYQDAV LLQRPQRLAEAVVVRGVLVGLHRQLDHRNVRLRIHQHERDPRAVVQPARVVHVDGFKSGFV* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,348.884 | ||
Theoretical pI: | 11.830 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 51.385 | ||
aromaticity | 0.028 | ||
GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.188 | ||
sheet | 0.265 |