Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331450.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
RLIPPPXAVVGGGFLARDITFQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGNAAVVLQNCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQ KCRIGATSDLKPVQSSFPTYLGRPWKEYSRTVIMQTDISDVINPAGWYPWDGNFALNTLFYAEYQNTGAGAGTGSRVTWAGFRVLTSASQAQPFTAGNFIGGGNGLQATGFPFSL | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 17,627.856 | ||
Theoretical pI: | 11.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 101.453 | ||
aromaticity | 0.019 | ||
GRAVY | -1.205 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.305 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331450.1 | 5prime_partial | 207 | 705-82(-) |
Amino Acid sequence : | |||
KRKRESGGLQPIPATNKVTRRERLRLRRARQNPKPRPSHPTSGTGAGAGVLILGVEESVEREVAVPRIPSRRIDNVANISLHDYSPRILLPRPPKIRRKAALHRLEIRGGADPAFLDDNA GVLVGVVAALGGDHVALAGVGAASVDVAVLEDDGGVAEDEVDSSGDDAAGVELAEGVDVESVLVGEHVAAVEGAKIGVHAEGHRLML* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 17,627.856 | ||
Theoretical pI: | 11.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 101.453 | ||
aromaticity | 0.019 | ||
GRAVY | -1.205 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.305 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331450.1 | 5prime_partial | 155 | 3-470(+) |
Amino Acid sequence : | |||
FNSATXCGGGRRVLSPGHHIPEHGGAVKASGGGPPRERRSLRLLPLRHARLPRHSLRPLPPPVLHRLHHRRNCRLHLRQRRRRPPELRHPRSPPQLRPAQHGHRPRPRRPQPEHRHCHPE MPDRRHLGSQAGAEQLSDVSWAAVEGVFEDCNHAD* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,627.856 | ||
Theoretical pI: | 11.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 101.453 | ||
aromaticity | 0.019 | ||
GRAVY | -1.205 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.305 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331450.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
RLIPPPXAVVGGGFLARDITFQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGNAAVVLQNCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQ KCRIGATSDLKPVQSSFPTYLGRPWKEYSRTVIMQTDISDVINPAGWYPWDGNFALNTLFYAEYQNTGAGAGTGSRVTWAGFRVLTSASQAQPFTAGNFIGGGNGLQATGFPFSL | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 17,627.856 | ||
Theoretical pI: | 11.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 101.453 | ||
aromaticity | 0.019 | ||
GRAVY | -1.205 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.305 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331450.1 | 5prime_partial | 207 | 705-82(-) |
Amino Acid sequence : | |||
KRKRESGGLQPIPATNKVTRRERLRLRRARQNPKPRPSHPTSGTGAGAGVLILGVEESVEREVAVPRIPSRRIDNVANISLHDYSPRILLPRPPKIRRKAALHRLEIRGGADPAFLDDNA GVLVGVVAALGGDHVALAGVGAASVDVAVLEDDGGVAEDEVDSSGDDAAGVELAEGVDVESVLVGEHVAAVEGAKIGVHAEGHRLML* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 17,627.856 | ||
Theoretical pI: | 11.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 101.453 | ||
aromaticity | 0.019 | ||
GRAVY | -1.205 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.305 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331450.1 | 5prime_partial | 155 | 3-470(+) |
Amino Acid sequence : | |||
FNSATXCGGGRRVLSPGHHIPEHGGAVKASGGGPPRERRSLRLLPLRHARLPRHSLRPLPPPVLHRLHHRRNCRLHLRQRRRRPPELRHPRSPPQLRPAQHGHRPRPRRPQPEHRHCHPE MPDRRHLGSQAGAEQLSDVSWAAVEGVFEDCNHAD* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,627.856 | ||
Theoretical pI: | 11.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 101.453 | ||
aromaticity | 0.019 | ||
GRAVY | -1.205 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.305 | ||
sheet | 0.227 |