| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331451.1 | 5prime_partial | 248 | 1-747(+) |
Amino Acid sequence : | |||
| IYSIIERSLKLRIIQRDTNQIKNACSKNKHKRQYRFNPSKSKRKRESGGLQPIPATNKVTRRERLRLRRARQNPKPRPSHPTSGTGAGAGVLILGVEESVEREVAVPRIPSRRIDNVANI SLHDYSPRILLPRPPKIRRKAALHRLEIRGGADPAFLDDNAGVLVGVVAALGGDHVALAGVGAASVDVAVLEDDGGVAEDEVDSSGDDAAGVELAEGVDVESVLVGEHVAAVEGAKIGVH AEGHRLML* | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 16,005.004 | ||
| Theoretical pI: | 11.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 99.749 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.290 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331451.1 | 5prime_partial | 220 | 777-115(-) |
Amino Acid sequence : | |||
| GHHIQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGNAAVVLQNCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSF PTYLGRPWKEYSRTVIMQTDISDVINPAGWYPWDGNFALNTLFYAEYQNTGAGAGTGSRVTWAGFRVLTSASQAQPFTAGNFIGGGNWLQATGFPFSLGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 16,005.004 | ||
| Theoretical pI: | 11.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 99.749 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.290 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331451.1 | 5prime_partial | 138 | 775-359(-) |
Amino Acid sequence : | |||
| TSHPEHGGAVKASGGGPPRERRSLRLLPLRHARLPRHSLRPLPPPVLHRLHHRRNCRLHLRQRRRRPPELRHPRSPPQLRPAQHGHRPRPRRPQPEHRHCHPEMPDRRHLGSQAGAEQLS DVSWAAVEGVFEDCNHAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 16,005.004 | ||
| Theoretical pI: | 11.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 99.749 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.290 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331451.1 | 5prime_partial | 248 | 1-747(+) |
Amino Acid sequence : | |||
| IYSIIERSLKLRIIQRDTNQIKNACSKNKHKRQYRFNPSKSKRKRESGGLQPIPATNKVTRRERLRLRRARQNPKPRPSHPTSGTGAGAGVLILGVEESVEREVAVPRIPSRRIDNVANI SLHDYSPRILLPRPPKIRRKAALHRLEIRGGADPAFLDDNAGVLVGVVAALGGDHVALAGVGAASVDVAVLEDDGGVAEDEVDSSGDDAAGVELAEGVDVESVLVGEHVAAVEGAKIGVH AEGHRLML* | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 16,005.004 | ||
| Theoretical pI: | 11.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 99.749 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.290 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331451.1 | 5prime_partial | 220 | 777-115(-) |
Amino Acid sequence : | |||
| GHHIQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGNAAVVLQNCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSF PTYLGRPWKEYSRTVIMQTDISDVINPAGWYPWDGNFALNTLFYAEYQNTGAGAGTGSRVTWAGFRVLTSASQAQPFTAGNFIGGGNWLQATGFPFSLGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 16,005.004 | ||
| Theoretical pI: | 11.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 99.749 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.290 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331451.1 | 5prime_partial | 138 | 775-359(-) |
Amino Acid sequence : | |||
| TSHPEHGGAVKASGGGPPRERRSLRLLPLRHARLPRHSLRPLPPPVLHRLHHRRNCRLHLRQRRRRPPELRHPRSPPQLRPAQHGHRPRPRRPQPEHRHCHPEMPDRRHLGSQAGAEQLS DVSWAAVEGVFEDCNHAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 16,005.004 | ||
| Theoretical pI: | 11.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 99.749 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.290 | ||
| sheet | 0.239 | ||