| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331460.1 | complete | 181 | 42-587(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 16,125.062 | ||
| Theoretical pI: | 6.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 44.733 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.407 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.200 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331460.1 | 5prime_partial | 145 | 630-193(-) |
Amino Acid sequence : | |||
| ECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQV LKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,125.062 | ||
| Theoretical pI: | 6.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 44.733 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.407 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.200 | ||
| sheet | 0.228 | ||