| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331469.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
| SEKHELEVFTSKVYDQALDVVCQKMGVQSQFVEEGFHNAVLRKGCQKLGFSALMPWMSGADIKKRMLKFSRTAHVFALARDRGSGSIASESNISYKVAKTDEESLMEGMERVLRILAAAG AEEIGTHHKTGKVLRVKEASSEEFERFVKEESRRPLEKLSAPVCSAHQMGSCRMGVDPKTSAV | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 15,844.435 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 77.939 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.734 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.185 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331469.1 | 5prime_partial | 130 | 551-159(-) |
Amino Acid sequence : | |||
| HRRRFRIHPHPAAPHLMRRAHRRRQLLQRPPALLLHKPLKLLTARLLHPQHLPRLVMRSYLLRPRRRQYSQHPLHSFHQTLFISFRHLVADVAFRCYRSRPSIPSQCENVRRAREFQHPF FYVGAGHPRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 15,844.435 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 77.939 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.734 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.185 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331469.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
| SEKHELEVFTSKVYDQALDVVCQKMGVQSQFVEEGFHNAVLRKGCQKLGFSALMPWMSGADIKKRMLKFSRTAHVFALARDRGSGSIASESNISYKVAKTDEESLMEGMERVLRILAAAG AEEIGTHHKTGKVLRVKEASSEEFERFVKEESRRPLEKLSAPVCSAHQMGSCRMGVDPKTSAV | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 15,844.435 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 77.939 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.734 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.185 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331469.1 | 5prime_partial | 130 | 551-159(-) |
Amino Acid sequence : | |||
| HRRRFRIHPHPAAPHLMRRAHRRRQLLQRPPALLLHKPLKLLTARLLHPQHLPRLVMRSYLLRPRRRQYSQHPLHSFHQTLFISFRHLVADVAFRCYRSRPSIPSQCENVRRAREFQHPF FYVGAGHPRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 15,844.435 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 77.939 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.734 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.185 | ||
| sheet | 0.238 | ||