| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331486.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| NYLPGKLKGCFLFMGAFPEDSEIRVPKLIKLWVAEGFLKTEMLKLFEEVAMDFLEQLIGRNLISVRKASSNNRMKICGMHDSLRELAENESKMEKFCHSRKKYEQQLDPGWDSQRRVSIH RNILLCLEEVYNSTQQIRYARSLLCVGSHHHHPLPFVLTFDLLRVLDAFTAYFIQFPEEFLQLVHLTYLSFTYNGKISSKIVNLKKLQVLMGRRHPKIVFVGASFLPDEIWT | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 27,125.423 | ||
| Theoretical pI: | 9.044 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 48.542 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.194 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331486.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| NYLPGKLKGCFLFMGAFPEDSEIRVPKLIKLWVAEGFLKTEMLKLFEEVAMDFLEQLIGRNLISVRKASSNNRMKICGMHDSLRELAENESKMEKFCHSRKKYEQQLDPGWDSQRRVSIH RNILLCLEEVYNSTQQIRYARSLLCVGSHHHHPLPFVLTFDLLRVLDAFTAYFIQFPEEFLQLVHLTYLSFTYNGKISSKIVNLKKLQVLMGRRHPKIVFVGASFLPDEIWT | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 27,125.423 | ||
| Theoretical pI: | 9.044 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 48.542 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.194 | ||
| sheet | 0.280 | ||