Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331501.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
DLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKEGTVNAYKKQFQSDLVSFLRSRSKELKPGGSMFLMLLGR TSPDPEDQGAWILTFSACYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPHDAVEITRAYVSLCRSLTGGLFDA | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,003.844 | ||
Theoretical pI: | 5.120 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 47.604 | ||
aromaticity | 0.124 | ||
GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.267 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331501.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
DLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKEGTVNAYKKQFQSDLVSFLRSRSKELKPGGSMFLMLLGR TSPDPEDQGAWILTFSACYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPHDAVEITRAYVSLCRSLTGGLFDA | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,003.844 | ||
Theoretical pI: | 5.120 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 47.604 | ||
aromaticity | 0.124 | ||
GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.267 | ||
sheet | 0.244 |