| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331501.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
| DLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKEGTVNAYKKQFQSDLVSFLRSRSKELKPGGSMFLMLLGR TSPDPEDQGAWILTFSACYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPHDAVEITRAYVSLCRSLTGGLFDA | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 25,003.844 | ||
| Theoretical pI: | 5.120 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 47.604 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.267 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331501.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
| DLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKEGTVNAYKKQFQSDLVSFLRSRSKELKPGGSMFLMLLGR TSPDPEDQGAWILTFSACYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPHDAVEITRAYVSLCRSLTGGLFDA | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 25,003.844 | ||
| Theoretical pI: | 5.120 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 47.604 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.267 | ||
| sheet | 0.244 | ||