| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331509.1 | complete | 176 | 2-532(+) |
Amino Acid sequence : | |||
| MSFYGDSPRGMVESAFEYARICRKLDFHNFVFSMKASNPVIMVQAYRLLAAEMNVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKT SELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRDGSVLMSVSLDS* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,820.341 | ||
| Theoretical pI: | 5.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 47.279 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.233 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331509.1 | complete | 176 | 2-532(+) |
Amino Acid sequence : | |||
| MSFYGDSPRGMVESAFEYARICRKLDFHNFVFSMKASNPVIMVQAYRLLAAEMNVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKT SELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRDGSVLMSVSLDS* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,820.341 | ||
| Theoretical pI: | 5.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 47.279 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.233 | ||
| sheet | 0.290 | ||