| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331518.1 | 3prime_partial | 255 | 58-822(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHPHPSGRFVI GGPHGDAGLTGRKII | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 11,698.195 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331518.1 | 5prime_partial | 103 | 822-511(-) |
Amino Acid sequence : | |||
| NDLPTSETGISMWTTNHETPRWVRVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,698.195 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331518.1 | 3prime_partial | 255 | 58-822(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHPHPSGRFVI GGPHGDAGLTGRKII | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 11,698.195 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331518.1 | 5prime_partial | 103 | 822-511(-) |
Amino Acid sequence : | |||
| NDLPTSETGISMWTTNHETPRWVRVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,698.195 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.223 | ||