Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331532.1 | complete | 151 | 94-549(+) |
Amino Acid sequence : | |||
MNSIDVQDWEILPNNGYLEDGGTKIHSNNPNNHSFKSYFFNPPKSVETRVHPEMSDQLAHEPMSQKDATIPEEDEDGRVSQVLPKKMKETGGGDFRFEEKGNIKADLEVSGDRFNIWKMS LFGVAAAGVCVIISWSNTNKQQQNRKQNRRI* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 17,165.911 | ||
Theoretical pI: | 5.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 53.172 | ||
aromaticity | 0.079 | ||
GRAVY | -0.909 | ||
Secondary Structure Fraction | |||
Helix | 0.238 | ||
turn | 0.298 | ||
sheet | 0.192 |