| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331532.1 | complete | 151 | 94-549(+) |
Amino Acid sequence : | |||
| MNSIDVQDWEILPNNGYLEDGGTKIHSNNPNNHSFKSYFFNPPKSVETRVHPEMSDQLAHEPMSQKDATIPEEDEDGRVSQVLPKKMKETGGGDFRFEEKGNIKADLEVSGDRFNIWKMS LFGVAAAGVCVIISWSNTNKQQQNRKQNRRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 17,165.911 | ||
| Theoretical pI: | 5.811 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 53.172 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.909 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.298 | ||
| sheet | 0.192 | ||