| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331538.1 | 5prime_partial | 240 | 3-725(+) |
Amino Acid sequence : | |||
| KECGKAFQSWKALFGHMKCHSANVNAKNCMDEDSAIMDSQSDNEAAAPSCRKKRSDRMTKRCTATTASSSLTATNSMSEMDQHEQEEVALSLIILSRDKGWAADNSPQLSEAEETDHSPK RMRKSRCVTQLDENDETESKFTCSICKKAFSSYQALGGHRASHKKFKGCCAPENSLETKNSNNQSENAVSRKKSRDHECPICYKVFPSGQALGGHKRSHLIMDQIKNEGAAEMEKPGQEI * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 11,059.062 | ||
| Theoretical pI: | 11.704 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 35.605 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.841 | ||
Secondary Structure Fraction | |||
| Helix | 0.431 | ||
| turn | 0.225 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331538.1 | complete | 102 | 593-285(-) |
Amino Acid sequence : | |||
| MISAFLPRNRILALVVGVFGFEAVLWGAAALELLVAGSVPAQSLVRTKRFLANGAREFALGFVVLIELCHAPRLSHPFWRVIRFLSFGQLGTVVGGPAFVPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,059.062 | ||
| Theoretical pI: | 11.704 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 35.605 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.841 | ||
Secondary Structure Fraction | |||
| Helix | 0.431 | ||
| turn | 0.225 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331538.1 | 5prime_partial | 240 | 3-725(+) |
Amino Acid sequence : | |||
| KECGKAFQSWKALFGHMKCHSANVNAKNCMDEDSAIMDSQSDNEAAAPSCRKKRSDRMTKRCTATTASSSLTATNSMSEMDQHEQEEVALSLIILSRDKGWAADNSPQLSEAEETDHSPK RMRKSRCVTQLDENDETESKFTCSICKKAFSSYQALGGHRASHKKFKGCCAPENSLETKNSNNQSENAVSRKKSRDHECPICYKVFPSGQALGGHKRSHLIMDQIKNEGAAEMEKPGQEI * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 11,059.062 | ||
| Theoretical pI: | 11.704 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 35.605 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.841 | ||
Secondary Structure Fraction | |||
| Helix | 0.431 | ||
| turn | 0.225 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331538.1 | complete | 102 | 593-285(-) |
Amino Acid sequence : | |||
| MISAFLPRNRILALVVGVFGFEAVLWGAAALELLVAGSVPAQSLVRTKRFLANGAREFALGFVVLIELCHAPRLSHPFWRVIRFLSFGQLGTVVGGPAFVPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,059.062 | ||
| Theoretical pI: | 11.704 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 35.605 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.841 | ||
Secondary Structure Fraction | |||
| Helix | 0.431 | ||
| turn | 0.225 | ||
| sheet | 0.324 | ||