| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331547.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
| ARSFSALNDVIQRQRIIAILFLQALFRGFPFCLPVSQPPAFRINGGPFCPLLLCEFIRLLRQRVQALLIRNLVAKCSQLAFVLQRLIFMRQQGFLLCRQLATLRRLLQYRELTLRLPKIP ALLADFLICSGMLLQRREFC | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,998.658 | ||
| Theoretical pI: | 9.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 49.364 | ||
| aromaticity | 0.050 | ||
| GRAVY | -1.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.136 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331547.1 | internal | 140 | 421-2(-) |
Amino Acid sequence : | |||
| AELPTLEKHAGANEKISQQRRDFWKAESQFAVLEEAAQRRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQERLNALAQQADKFAQQQRAKRAAIDAKSRGLTDRQAEREATEQRLKE QYGDNPLALNNVIQSRKRPG | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,998.658 | ||
| Theoretical pI: | 9.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 49.364 | ||
| aromaticity | 0.050 | ||
| GRAVY | -1.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.136 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331547.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
| ARSFSALNDVIQRQRIIAILFLQALFRGFPFCLPVSQPPAFRINGGPFCPLLLCEFIRLLRQRVQALLIRNLVAKCSQLAFVLQRLIFMRQQGFLLCRQLATLRRLLQYRELTLRLPKIP ALLADFLICSGMLLQRREFC | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,998.658 | ||
| Theoretical pI: | 9.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 49.364 | ||
| aromaticity | 0.050 | ||
| GRAVY | -1.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.136 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331547.1 | internal | 140 | 421-2(-) |
Amino Acid sequence : | |||
| AELPTLEKHAGANEKISQQRRDFWKAESQFAVLEEAAQRRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQERLNALAQQADKFAQQQRAKRAAIDAKSRGLTDRQAEREATEQRLKE QYGDNPLALNNVIQSRKRPG | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,998.658 | ||
| Theoretical pI: | 9.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 49.364 | ||
| aromaticity | 0.050 | ||
| GRAVY | -1.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.136 | ||
| sheet | 0.364 | ||