| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331548.1 | 5prime_partial | 122 | 2-370(+) |
Amino Acid sequence : | |||
| SSSLIWLHTLILSMAKYAAIVLAIMVCVVLAESAPCDNVYKNLSPCRAALKQGSPPTASCCNGMKTLNNAATTKAARKSACECAKKLATSYKVNGQTASQLVKKCKVNLGYTISNNVDCN KV* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,257.785 | ||
| Theoretical pI: | 10.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 61.537 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.395 | ||
| turn | 0.134 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331548.1 | 5prime_partial | 119 | 846-487(-) |
Amino Acid sequence : | |||
| CRQLATLRRFLQYRELTLRLPQIPALLADFLIASGMLLQRPEFCLKRQQGSMSTVFLTIARRHLHAGLFRLFQRRKTNKQYDAINRITSYYISYIIRFYYKVAYNSQQELIVPKLKIKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 14,257.785 | ||
| Theoretical pI: | 10.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 61.537 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.395 | ||
| turn | 0.134 | ||
| sheet | 0.269 | ||