Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331548.1 | 5prime_partial | 122 | 2-370(+) |
Amino Acid sequence : | |||
SSSLIWLHTLILSMAKYAAIVLAIMVCVVLAESAPCDNVYKNLSPCRAALKQGSPPTASCCNGMKTLNNAATTKAARKSACECAKKLATSYKVNGQTASQLVKKCKVNLGYTISNNVDCN KV* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 14,257.785 | ||
Theoretical pI: | 10.679 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
Instability index: | 61.537 | ||
aromaticity | 0.126 | ||
GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
Helix | 0.395 | ||
turn | 0.134 | ||
sheet | 0.269 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331548.1 | 5prime_partial | 119 | 846-487(-) |
Amino Acid sequence : | |||
CRQLATLRRFLQYRELTLRLPQIPALLADFLIASGMLLQRPEFCLKRQQGSMSTVFLTIARRHLHAGLFRLFQRRKTNKQYDAINRITSYYISYIIRFYYKVAYNSQQELIVPKLKIKL* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 14,257.785 | ||
Theoretical pI: | 10.679 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
Instability index: | 61.537 | ||
aromaticity | 0.126 | ||
GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
Helix | 0.395 | ||
turn | 0.134 | ||
sheet | 0.269 |