| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331549.1 | 5prime_partial | 217 | 686-33(-) |
Amino Acid sequence : | |||
| RGHPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWV LHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,005.348 | ||
| Theoretical pI: | 5.814 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 19.840 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.212 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331549.1 | 5prime_partial | 217 | 686-33(-) |
Amino Acid sequence : | |||
| RGHPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWV LHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,005.348 | ||
| Theoretical pI: | 5.814 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 19.840 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.212 | ||
| sheet | 0.281 | ||