Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331550.1	internal	264	1-792(+)
Amino Acid sequence :
VELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYL KSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWSDD KCIEILKKCKEAIXTSTGKVMIVD
Physicochemical properties
Number of amino acids:		264
Molecular weight:		10,893.269
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		50.544
aromaticity		0.058
GRAVY		-0.044
Secondary Structure Fraction
Helix		0.221
turn		0.375
sheet		0.192

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331550.1	complete	125	411-34(-)
Amino Acid sequence :
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		10,893.269
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		50.544
aromaticity		0.058
GRAVY		-0.044
Secondary Structure Fraction
Helix		0.221
turn		0.375
sheet		0.192

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331550.1	5prime_partial	105	794-477(-)
Amino Acid sequence :
ASTIITFPVLXGIASLHFFRISMHLSSLQSCNTHMSMTASAFGRLSNISPPTKSTPLRGGASATTSGRSNAIPRTHGNASTSFPIAIPWRPPTSTTDRTPLNAVG*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		10,893.269
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		50.544
aromaticity		0.058
GRAVY		-0.044
Secondary Structure Fraction
Helix		0.221
turn		0.375
sheet		0.192

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331550.1	internal	264	1-792(+)
Amino Acid sequence :
VELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYL KSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWSDD KCIEILKKCKEAIXTSTGKVMIVD
Physicochemical properties
Number of amino acids:		264
Molecular weight:		10,893.269
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		50.544
aromaticity		0.058
GRAVY		-0.044
Secondary Structure Fraction
Helix		0.221
turn		0.375
sheet		0.192

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331550.1	complete	125	411-34(-)
Amino Acid sequence :
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		10,893.269
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		50.544
aromaticity		0.058
GRAVY		-0.044
Secondary Structure Fraction
Helix		0.221
turn		0.375
sheet		0.192

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331550.1	5prime_partial	105	794-477(-)
Amino Acid sequence :
ASTIITFPVLXGIASLHFFRISMHLSSLQSCNTHMSMTASAFGRLSNISPPTKSTPLRGGASATTSGRSNAIPRTHGNASTSFPIAIPWRPPTSTTDRTPLNAVG*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		10,893.269
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		50.544
aromaticity		0.058
GRAVY		-0.044
Secondary Structure Fraction
Helix		0.221
turn		0.375
sheet		0.192