| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331551.1 | internal | 165 | 2-496(+) |
Amino Acid sequence : | |||
| LNTKSSMGSLEVERKTVGWAARDPSGVLSPYEYTLRNTGPQDVYVKVMCCGICHTDVHQIKNDLGMSNYPMVPGHEVVGEVVEVGSEVTKFRAGDVVGVGCIVGSCGNCRPCNSDIEQYC NKKIWSYNDVYPDGKPTQGGFAGAMVVDQKFVVKIPDGLAPEQAA | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 17,764.012 | ||
| Theoretical pI: | 5.331 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21930 | ||
| Instability index: | 22.653 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.285 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331551.1 | internal | 165 | 2-496(+) |
Amino Acid sequence : | |||
| LNTKSSMGSLEVERKTVGWAARDPSGVLSPYEYTLRNTGPQDVYVKVMCCGICHTDVHQIKNDLGMSNYPMVPGHEVVGEVVEVGSEVTKFRAGDVVGVGCIVGSCGNCRPCNSDIEQYC NKKIWSYNDVYPDGKPTQGGFAGAMVVDQKFVVKIPDGLAPEQAA | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 17,764.012 | ||
| Theoretical pI: | 5.331 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21930 | ||
| Instability index: | 22.653 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.285 | ||
| sheet | 0.170 | ||