Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331557.1 | 5prime_partial | 236 | 3-713(+) |
Amino Acid sequence : | |||
GNLSENFVDIMLEIYSEKKDGASLDREGIKALALDVIVGGTDTISTTLEWAMTELLRHPAKLKKLQKEVREIVKANREITNDDISQMPYLKAVIKETLRYHPPLPLLAPRVASKDVTING FDVLAGTVVMINAWAISRDEAIWNDAKKFQPERFLNTPIDFKGTDFKFIPFGAGRRRCPGIAYGEATAELLLANIVHKFNWKLPGEAQGGKLGINETPGIAVGRATPLYALTVKSA* | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 26,043.816 | ||
Theoretical pI: | 8.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 20.931 | ||
aromaticity | 0.076 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.212 | ||
sheet | 0.288 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331557.1 | 5prime_partial | 236 | 3-713(+) |
Amino Acid sequence : | |||
GNLSENFVDIMLEIYSEKKDGASLDREGIKALALDVIVGGTDTISTTLEWAMTELLRHPAKLKKLQKEVREIVKANREITNDDISQMPYLKAVIKETLRYHPPLPLLAPRVASKDVTING FDVLAGTVVMINAWAISRDEAIWNDAKKFQPERFLNTPIDFKGTDFKFIPFGAGRRRCPGIAYGEATAELLLANIVHKFNWKLPGEAQGGKLGINETPGIAVGRATPLYALTVKSA* | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 26,043.816 | ||
Theoretical pI: | 8.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 20.931 | ||
aromaticity | 0.076 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.212 | ||
sheet | 0.288 |