| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331562.1 | internal | 175 | 1-525(+) |
Amino Acid sequence : | |||
| EGIARLTTXGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFI INKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSR | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 19,265.521 | ||
| Theoretical pI: | 5.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 42.799 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.247 | ||
| sheet | 0.247 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331562.1 | internal | 175 | 1-525(+) |
Amino Acid sequence : | |||
| EGIARLTTXGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFI INKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSR | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 19,265.521 | ||
| Theoretical pI: | 5.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 42.799 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.247 | ||
| sheet | 0.247 | ||