Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331564.1 | 5prime_partial | 196 | 1-591(+) |
Amino Acid sequence : | |||
LEAKYQKLYQPLYTKRYEIVNGVVEVEGGATEQAGQDGEDKGVPDFWLTAMKNNEVLAEEISERDEGALKFLRDIKWSRIENPKGFKLEFYFDTNPFFKNSVLTKTYHMIDEDEPILEKA IGTEIEWHPGKCLTQKILKKKPKKGSKNAKPITKTEQCESFFNFFSPPQVPDEEDDIDEDAAEELQNLMEQDYDIG* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 13,526.774 | ||
Theoretical pI: | 9.182 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 44.856 | ||
aromaticity | 0.147 | ||
GRAVY | 0.407 | ||
Secondary Structure Fraction | |||
Helix | 0.448 | ||
turn | 0.250 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331564.1 | complete | 116 | 384-34(-) |
Amino Acid sequence : | |||
MPLNLRPNSLLQDRLIFINHVVSFCQNRILEEWIGVKIKFKLEAFRIFYSGPFNISEKFESALITLRNLFSKYFIVFHCSKPEIRNSLILAILACLLSSTSFDFNNTIYNFISLGI* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,526.774 | ||
Theoretical pI: | 9.182 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 44.856 | ||
aromaticity | 0.147 | ||
GRAVY | 0.407 | ||
Secondary Structure Fraction | |||
Helix | 0.448 | ||
turn | 0.250 | ||
sheet | 0.233 |