Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331578.1 | 5prime_partial | 129 | 3-392(+) |
Amino Acid sequence : | |||
GVQDTTQIHTHMCYSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYAEVKPALENMVSAAKL LRTQLASAK* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 11,227.922 | ||
Theoretical pI: | 9.391 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 58.669 | ||
aromaticity | 0.120 | ||
GRAVY | 0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.300 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331578.1 | 5prime_partial | 111 | 2-337(+) |
Amino Acid sequence : | |||
RSPRYHSDPHPHVLLQLQRHHPLHHQHGRRRDHNRELTFGREAAVGVPRGSEVRCRNRAGRVRHPLPENPINGGDRGPDQQDARGPRDQHLVGEPRLRSQDSKVRRGEACP* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,227.922 | ||
Theoretical pI: | 9.391 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 58.669 | ||
aromaticity | 0.120 | ||
GRAVY | 0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.300 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331578.1 | complete | 100 | 343-41(-) |
Amino Acid sequence : | |||
MFSRAGFTSAYFRVLRPQSGFTHKMLVSRTASILLIRSAISSVDGILGEWMSYTPGPIPAPYFTPSRNTDSSFSSEREFSIVITSASMLMMEWMMSLKLE* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,227.922 | ||
Theoretical pI: | 9.391 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 58.669 | ||
aromaticity | 0.120 | ||
GRAVY | 0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.300 | ||
sheet | 0.270 |