| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331581.1 | internal | 109 | 3-329(+) |
Amino Acid sequence : | |||
| TVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDKLDSIATQRGSSVGNAGGAANKF | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,776.320 | ||
| Theoretical pI: | 7.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.266 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.284 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331581.1 | internal | 109 | 3-329(+) |
Amino Acid sequence : | |||
| TVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDKLDSIATQRGSSVGNAGGAANKF | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,776.320 | ||
| Theoretical pI: | 7.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.266 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.284 | ||
| sheet | 0.257 | ||