Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331584.1 | 5prime_partial | 191 | 3-578(+) |
Amino Acid sequence : | |||
PWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPVLDQMVADGKYEGSFDFIFVDADKDNYLNYHKRL IELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRII* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,337.403 | ||
Theoretical pI: | 4.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 31.629 | ||
aromaticity | 0.094 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.209 | ||
sheet | 0.283 |