Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331588.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
LSHADASQLPPSSAVSKQEAAEIVRGEFDAKSAEKLIGFIKASEANLKFIALSNGAISRFVEVFTESDEIRIRELILEVFDLISSENGVREKLNELILKSGDGRDCLSSFATVLQKGNTE SKVKSAKILELIALNPESRHKIAEKQGILHNLYILTTTETDTAIEAGLSALLAIATTRPAKKELIRFGIVRTVGRILSGPEAVRGVIEKAVAVLEMIATCTEGRSAIGEDAECVAEIVRR LMKCSGAA | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 17,276.840 | ||
Theoretical pI: | 11.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 99.728 | ||
aromaticity | 0.093 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.338 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331588.1 | 5prime_partial | 151 | 744-289(-) |
Amino Acid sequence : | |||
PHPNISSASSRSPPHIPRPPQSRSSPPYTWQSFPAPLPLSQSLREPLLDRRGFSQRFGLFRTGLIPSLPVSWLRSLTEQIIRLRSPCRFLWLLECRDCGEFLVFPRFCGAIQDLERLAPE SSPISPLIRCFLSVKPLRTTTSNLFRHRSSK* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 17,276.840 | ||
Theoretical pI: | 11.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 99.728 | ||
aromaticity | 0.093 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.338 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331588.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
LSHADASQLPPSSAVSKQEAAEIVRGEFDAKSAEKLIGFIKASEANLKFIALSNGAISRFVEVFTESDEIRIRELILEVFDLISSENGVREKLNELILKSGDGRDCLSSFATVLQKGNTE SKVKSAKILELIALNPESRHKIAEKQGILHNLYILTTTETDTAIEAGLSALLAIATTRPAKKELIRFGIVRTVGRILSGPEAVRGVIEKAVAVLEMIATCTEGRSAIGEDAECVAEIVRR LMKCSGAA | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 17,276.840 | ||
Theoretical pI: | 11.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 99.728 | ||
aromaticity | 0.093 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.338 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331588.1 | 5prime_partial | 151 | 744-289(-) |
Amino Acid sequence : | |||
PHPNISSASSRSPPHIPRPPQSRSSPPYTWQSFPAPLPLSQSLREPLLDRRGFSQRFGLFRTGLIPSLPVSWLRSLTEQIIRLRSPCRFLWLLECRDCGEFLVFPRFCGAIQDLERLAPE SSPISPLIRCFLSVKPLRTTTSNLFRHRSSK* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 17,276.840 | ||
Theoretical pI: | 11.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 99.728 | ||
aromaticity | 0.093 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.338 | ||
sheet | 0.205 |