| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331597.1 | internal | 270 | 2-811(+) |
Amino Acid sequence : | |||
| KALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDV LVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQID EAALREGLPPRKSEHAFYLDWAVHSFRITN | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 12,403.331 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 108.759 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.269 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331597.1 | complete | 108 | 150-476(+) |
Amino Acid sequence : | |||
| MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSLRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,403.331 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 108.759 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.269 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331597.1 | internal | 270 | 2-811(+) |
Amino Acid sequence : | |||
| KALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDV LVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQID EAALREGLPPRKSEHAFYLDWAVHSFRITN | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 12,403.331 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 108.759 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.269 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331597.1 | complete | 108 | 150-476(+) |
Amino Acid sequence : | |||
| MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSLRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,403.331 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 108.759 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.269 | ||
| sheet | 0.287 | ||