| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331601.1 | internal | 281 | 2-844(+) |
Amino Acid sequence : | |||
| NSLLSTALSSSPSSLQVKRLGIPVRSTDSSVIFKPQRFCSPSRAATGFSSSLDTGLSTELDAVTSYSEIVPDTVVFDDFERFPPTAATVSSSLILGICSLPDTKFRSAVDTALAASECYG LEKSDDRLSCFFDKALVNVGGDLAKLVPGRVSTEVDARLAYDKQAIVRKVHNLLNLYSKIDVPPERLLFKIPATWQGIEASSILESEGIQTHMTFVYSFCQAAAAAQAGASVIQIFVGRL RDWARNHTGDSEVEAALRRGEDPGVALVTKALHYIHKYGHK | |||
Physicochemical properties | |||
| Number of amino acids: | 281 | ||
| Molecular weight: | 30,375.070 | ||
| Theoretical pI: | 6.341 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 43.864 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.242 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331601.1 | internal | 281 | 2-844(+) |
Amino Acid sequence : | |||
| NSLLSTALSSSPSSLQVKRLGIPVRSTDSSVIFKPQRFCSPSRAATGFSSSLDTGLSTELDAVTSYSEIVPDTVVFDDFERFPPTAATVSSSLILGICSLPDTKFRSAVDTALAASECYG LEKSDDRLSCFFDKALVNVGGDLAKLVPGRVSTEVDARLAYDKQAIVRKVHNLLNLYSKIDVPPERLLFKIPATWQGIEASSILESEGIQTHMTFVYSFCQAAAAAQAGASVIQIFVGRL RDWARNHTGDSEVEAALRRGEDPGVALVTKALHYIHKYGHK | |||
Physicochemical properties | |||
| Number of amino acids: | 281 | ||
| Molecular weight: | 30,375.070 | ||
| Theoretical pI: | 6.341 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 43.864 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.242 | ||
| sheet | 0.253 | ||