Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331603.1 | 5prime_partial | 130 | 3-395(+) |
Amino Acid sequence : | |||
LEAPDQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEQATDALIDLIKEH GRWVEPPVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,305.153 | ||
Theoretical pI: | 4.756 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 40.674 | ||
aromaticity | 0.069 | ||
GRAVY | -0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.215 | ||
sheet | 0.285 |